PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006750-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 314aa    MW: 34753.1 Da    PI: 7.5323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006750-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.81.4e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEde+lv+++k++G g+W++ +++ g+ R++k+c++rw +yl
    NNU_006750-RA 14 KGPWSPEEDEILVEYIKKHGHGSWRSLPKHAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.11.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ +++++  lG++ W++Ia+ ++ gRt++++k++w+++l
    NNU_006750-RA  67 RGPFTHSEEKTIIQLHGILGNR-WAAIASQLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-27564IPR009057Homeodomain-like
PROSITE profilePS5129426.089965IPR017930Myb domain
SuperFamilySSF466892.85E-3111108IPR009057Homeodomain-like
SMARTSM007174.4E-161363IPR001005SANT/Myb domain
PfamPF002497.9E-181461IPR001005SANT/Myb domain
CDDcd001672.70E-131661No hitNo description
Gene3DG3DSA:1.10.10.609.1E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129419.57166116IPR017930Myb domain
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1467112IPR001005SANT/Myb domain
CDDcd001674.12E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRAPCCDKQ GLKKGPWSPE EDEILVEYIK KHGHGSWRSL PKHAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF THSEEKTIIQ LHGILGNRWA AIASQLPGRT DNEIKNFWNT HLKKRLLSMG  120
LDPQTHAPPA LSSGLIVTPS ASPSTRHMAQ WESARLEAEA RLSRESLLSN HPSSSKKSDT  180
DYFLRMWNSE IGESFRRVNG RESLACQSPM SQASSSTKWG SGMTTEVVPA AMAVALTTDQ  240
PERVQCGNSR SDAEEVAARS DCSSSNELDE SSETSLQLLL DFPASEDMSF FQGQMGSFSL  300
LPNMLSESSL NSTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255443.10.0PREDICTED: transcription factor MYB3-like
TrEMBLD7UC601e-149D7UC60_VITVI; Putative uncharacterized protein
STRINGVIT_15s0046g03190.t011e-148(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-120myb domain protein 17